PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_2AS_7C177F9DB.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family NF-YA
Protein Properties Length: 303aa    MW: 33076.1 Da    PI: 10.1061
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_2AS_7C177F9DB.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA102.34.4e-32151207158
              CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                            +ep++VNaKQy++Il+RRq Rakle+++kl  k+rkpylheSRh+hA++R+Rg+gGrF
  Traes_2AS_7C177F9DB.1 151 EEPMFVNAKQYHAILRRRQIRAKLEAQNKL-VKARKPYLHESRHRHAMKRARGTGGRF 207
                            69****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005211.2E-37149210IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115238.001150210IPR001289Nuclear transcription factor Y subunit A
PfamPF020454.5E-27152207IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006162.5E-24153175IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860155175IPR018362CCAAT-binding factor, conserved site
PRINTSPR006162.5E-24184207IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0009738Biological Processabscisic acid-activated signaling pathway
GO:0009785Biological Processblue light signaling pathway
GO:0010262Biological Processsomatic embryogenesis
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MCKMEDHPGH PISNYDFLSG NGVHTNKLVH KNYDRDSSSA KSGRSQQEAS ATSDSGLNEQ  60
HTSRPSSQSD NDNDHGKPDQ HMVKPLLSLG NPETVAPPPM LDCSQSFAYI PYTADAYAGI  120
FPGYASHAIV HPQLNAATNS RVPLPVEPAA EEPMFVNAKQ YHAILRRRQI RAKLEAQNKL  180
VKARKPYLHE SRHRHAMKRA RGTGGRFLNT KQLEEQKQKQ ASGGASCTKV LGKNTLLQDS  240
PAFAPSASAP ANVSSFSTIS MLANQERTCF PSVGFRPTVS FSALNGNGKL ATNGMHQRAS  300
MMR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A3e-23151212263NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1191200RHRHAMKRAR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU9027840.0GU902784.1 Triticum monococcum nuclear transcription factor Y subunit A9 mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010235752.11e-142PREDICTED: nuclear transcription factor Y subunit A-4-like
TrEMBLW5B2L50.0W5B2L5_WHEAT; Uncharacterized protein
STRINGMLOC_67781.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP137338121
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G54160.13e-34nuclear factor Y, subunit A5
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]